TB-500 Amino Acid Sequence and Structure: What the Primary Sources Show

> Research disclaimer: This article summarizes publicly available sequence databases and structural literature on thymosin β4 / TB-500 for informational and research purposes only. It is not medical advice. Materials sold as TB-500 are research chemicals and are not FDA-approved drugs. Nothing here is a dosing protocol, an efficacy claim, or a recommendation for human or veterinary use.

Quick answer: Human thymosin β4 is catalogued in UniProt as entry P62328 (gene TMSB4X). The mature peptide is a short, intrinsically disordered chain whose reference FASTA sequence is MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 residues in the UniProt canonical sequence commonly discussed in the actin literature; N-terminal processing and acetylation are described in the UniProt record). The central LKKTET (often written LKKTETQ) motif is the well-known actin-binding signature. Free Tβ4 does not have a single stable “drug-like” fold in solution; the best experimental atomic detail comes from actin-bound crystal structures (for example PDB entries associated with the 2014 Xue et al. work on Tβ4–actin complexes). Research-grade products labeled “TB-500” are frequently marketed as a shorter fragment (commonly discussed as an acetylated LKKTET-containing peptide), which is not identical to full-length Tβ4 — sequence identity on a certificate of analysis (COA) is how a lab checks which molecule it actually received.

Why Sequence Identity Matters Before Any Other Claim

TB-500 content online often jumps to recovery anecdotes. For a research buyer, the first question is narrower: which polypeptide is in the vial? Full-length thymosin β4, a truncated research fragment, a salt form, or a mislabeled related peptide will not answer the same experimental question. Our fragment vs full-length guide covers that product distinction; this article stays on the primary-sequence and structural facts that make the distinction real.

If a supplier cannot show a sequence that matches the lot’s COA (and ideally orthogonal mass data), later discussion of “what TB-500 does” is unanchored. Sequence first; interpretation second.

The Canonical Human Sequence (UniProt P62328)

UniProtKB/Swiss-Prot entry P62328 (TYB4_HUMAN) is the standard curated record for human thymosin β4. The UniProt FASTA for the entry (retrieved for this article) reads:

>sp|P62328|TYB4_HUMAN Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Key annotations researchers usually care about — and that you can verify on the UniProt page rather than trusting a blog — include:

Gene: TMSB4X (X-linked in humans).

Length: a short peptide (on the order of 40-odd amino acids in the mature processed form discussed throughout the actin literature).

N-terminal chemistry: the UniProt record describes acetylation and related processing features; many papers refer to an Ac-SDKP-containing N-terminal region (the tetrapeptide Ac-Ser-Asp-Lys-Pro is separately studied as a hemoregulatory fragment released from Tβ4).

Actin-binding motif: the LKKTET sequence (residues in the middle of the chain) is the classic β-thymosin actin contact motif cited across reviews.

NCBI’s RefSeq protein record for human thymosin β4 (NP_066932) points to the same gene product and links out to experimental structures of actin complexes. Use UniProt/NCBI as the source of truth if two vendor pages disagree on a residue.

Reading the Sequence Without Overclaiming Function

Writing the one-letter code on a page does not prove a biological outcome. What the sequence does establish:

1. Identity — whether a research lot matches full-length Tβ4 or a fragment.
2. Motif presence — whether the actin-associated LKKTET region is present in that lot’s claimed sequence.
3. Comparability — whether a paper that used full-length Tβ4 is even relevant to a vial labeled TB-500 fragment.

What it does not establish: dosing, human efficacy, or safety. Those require clinical evidence this article does not invent. See human clinical trials and side effects / safety for what published human work actually measured.

Intrinsically Disordered — Not a Compact Globular “Drug Shape”

Reviews of the β-thymosin family describe Tβ4 as intrinsically disordered in its free state: little stable tertiary structure until it binds a partner. A useful structural overview is Xue & Robinson’s account of actin-induced structure in β-thymosins (open literature discusses NMR preferences in the free peptide and crystallographic detail once actin is bound).

Practical consequences for research readers:

A colorful AlphaFold cartoon of free Tβ4 (for example computed models deposited as AF-P62328-F1 in public structure browsers) is a prediction, not a substitute for experimental free-state data. RCSB’s computed-model pages state that experimental verification is absent for those models.

The structurally informative experimental snapshots are mostly complexes with G-actin, where Tβ4 undergoes a disorder-to-order transition and contacts actin across a large interface.

So when a marketing page shows a ribbon diagram and implies “this is the TB-500 molecule’s shape in the bottle,” treat that as illustration, not as a solved free-peptide crystal structure.

Actin-Bound Structures: Where Atomic Detail Actually Exists

X-ray crystallography has produced high-resolution views of Tβ4 (or Tβ4-containing chimeras) bound to actin. A widely cited example is the work resolving how Tβ4’s N- and C-terminal helical segments engage actin and how exchange with profilin relates to filament assembly (Xue et al., structural papers in the mid-2010s; PDB entries linked from NCBI’s NP_066932 structure carousel include actin–peptide complexes such as 4PL7 / 4PL8 family depositions). In those bound states, literature describes:

An N-terminal helical segment contacting actin.

The LKKTET region contributing to the actin interface.

A C-terminal helical segment that helps bridge actin’s nucleotide-binding cleft in the fully bound conformation.

Those details matter for mechanism papers about actin sequestration. They do not by themselves prove that injecting a research peptide reproduces that crystallographic pose in a living human tissue. Structure explains binding hypotheses; it does not replace pharmacology.

For angiogenesis- and actin-adjacent discussion elsewhere on this site, see angiogenesis / blood-vessel research and mechanism of action — always against primary papers, not against a sequence tattooed on a product label.

Full-Length Tβ4 vs Common “TB-500” Fragment Labeling

In research-chemical markets, “TB-500” is often used for a short acetylated peptide containing the LKKTET motif, not for the entire 43-residue UniProt chain. That naming habit creates three recurring mistakes:

1. Citing full-length Tβ4 papers as if they measured the fragment in the vial.
2. Assuming identical actin affinity after truncating helices that structural papers describe as part of the interface.
3. Ignoring AcSDKP biology — the N-terminal tetrapeptide story is about processed full-length Tβ4 pathways, not automatically about every fragment SKU.

Our dedicated comparison of fragment vs full-length thymosin β4 is the place for product-labeling pitfalls. Here the structural point is simpler: truncation changes the molecule. Sequence length and terminal chemistry belong on the COA next to the purity percentage.

What a Serious COA Should Let You Verify

Without inventing vendor claims, a research-oriented checklist looks like this:

| Check | Why it matters |
| --- | --- |
| Stated amino-acid sequence | Matches full-length P62328 vs fragment |
| Molecular weight / mass spectrum | Orthogonal to the written sequence |
| Purity method (HPLC) | Purity ≠ identity |
| Lot number | Ties the PDF to the vial |
| Storage form (lyophilized) | Context for reconstitution work |

Third-party identity testing is discussed in our third-party testing / purity and manufacturing / synthesis articles. For reconstitution technique after identity is confirmed, see how to reconstitute TB-500 — technique pages still are not dosing advice.

Related Peptides and Why Sequence Charts Help

Comparison articles on this site only make sense when sequences differ in documented ways:

TB-500 vs BPC-157 — different primary sequences, different literature bases.

TB-500 vs thymosin α1 — both “thymosin” branded historically, not interchangeable chains.

TB-500 fragment 17–23 guide — motif-focused fragment discussion.

If two vials share a brand nickname but not a sequence, treat them as different reagents.

Practical Takeaways for Research Documentation

1. Cite UniProt P62328 / NCBI NP_066932 when you mean human full-length thymosin β4.
2. Write the exact sequence your lot claims in the lab notebook — do not write “TB-500” alone.
3. Prefer actin-complex PDB literature when discussing structure; label AlphaFold free-state images as computational.
4. Do not extrapolate crystallographic actin binding into human outcome claims.
5. Keep fragment vs full-length explicit in any methods section.

Frequently Asked Questions

What is the amino acid sequence of human thymosin β4?

UniProt P62328’s canonical FASTA sequence is MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. Confirm the current entry on UniProt in case of annotation updates, and read the feature table for acetylation and processing notes rather than relying on a secondary website.

Is TB-500 the same sequence as thymosin β4?

Not reliably in the research-chemical marketplace. Many products labeled TB-500 are sold as shorter fragments built around the LKKTET actin motif. Full-length Tβ4 is the UniProt P62328 chain. Check the COA sequence line.

Does TB-500 have a known 3D crystal structure by itself?

Free Tβ4 is widely described as intrinsically disordered. The strongest experimental atomic models are of actin-bound complexes. Computed free-state models (for example AlphaFold AF-P62328-F1) are predictions without experimental verification on their RCSB model pages.

What does the LKKTET motif mean?

It is the classic β-thymosin motif associated with actin binding in the structural and biochemical literature. Its presence on a label does not prove a particular experimental outcome; it identifies a sequence feature shared with Tβ4.

Why do papers mention AcSDKP if I bought “TB-500”?

Ac-SDKP (Ac-Ser-Asp-Lys-Pro) is discussed as an N-terminal tetrapeptide related to Tβ4 processing. Whether that pathway is relevant depends on whether your material is full-length Tβ4 and on the experimental system — it is not an automatic property of every fragment SKU.

Can sequence data tell me how to dose TB-500?

No. Primary sequence and structure explain molecular identity and binding hypotheses. They are not a clinical dosing guide. This site’s research articles do not provide dosing instructions for human use.

Before You Source a Lot

Confirm sequence identity against UniProt or your fragment specification before you treat any paper as applicable. Apollo Peptide Sciences publishes third-party COA documentation for its TB-500 lots — use that paperwork to match sequence and mass data to the vial, then see the peptide buying guide for the broader research-sourcing checklist.

---